PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00029430-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family MYB_related
Protein Properties Length: 388aa    MW: 41298.3 Da    PI: 7.8411
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00029430-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.82.1e-1295139347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT+eE+  ++ + ++lG+g+W+ Iar +   Rt+ q+ s+ qky
  PSME_00029430-RA  95 PWTEEEHRMFLLGLQKLGKGDWRGIARNFVISRTPTQVASHAQKY 139
                       8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501589.274320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129419.92588144IPR017930Myb domain
SuperFamilySSF466897.03E-1790145IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-1991143IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.2E-1192138IPR009057Homeodomain-like
SMARTSM007173.9E-1192142IPR001005SANT/Myb domain
PfamPF002499.9E-1195139IPR001005SANT/Myb domain
CDDcd001672.68E-995140No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MTRKCSHCGN NGHNSRTCPN RGGLKLFGVR LTDGPIRKSA SMGNLMMMAN PSSPADLSEP  60
ATAVAAAAAA DGYLSDGLVQ ASTSSNSRER KKGVPWTEEE HRMFLLGLQK LGKGDWRGIA  120
RNFVISRTPT QVASHAQKYF IRQSNMTRRK RRSSLFDMIP DSGATAVSVE EYSKAAPIDT  180
ICDGSVQNQI LPTGHTDCDS SSQIQILPPG HSVCDGSAQS QILSTGPNSA FNQGPLFEPN  240
NGAPLSSQPV SDHEFESNNS ENTAEAETSF SQAAAAMACG VPMAFPGFMA PLLPFPFPLW  300
HGFRPAATEL PPNSNVFKPR AEIPKAPVNI IDETGISKLS IGDPPGSIEP SGLSLKLLNK  360
PSRQSAFHTN PALNDNGFSS NSNAIHVA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0852140.0EF085214.1 Picea sitchensis clone WS0272_J01 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006600251.11e-104PREDICTED: MYB transcription factor MYB180 isoform X1
TrEMBLA9NV600.0A9NV60_PICSI; Putative uncharacterized protein
STRINGGLYMA17G15330.11e-103(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.17e-74MYB_related family protein